$59 GRAYBYTE WORDPRESS FILE MANAGER $36

SERVER : premium201.web-hosting.com #1 SMP Wed Mar 26 12:08:09 UTC 2025
SERVER IP : 172.67.217.254 | ADMIN IP 216.73.216.23
OPTIONS : CRL = ON | WGT = ON | SDO = OFF | PKEX = OFF
DEACTIVATED : NONE

/usr/share/locale/fr/LC_MESSAGES/

HOME
Current File : /usr/share/locale/fr/LC_MESSAGES//xkeyboard-config.mo
����$#�IHbIb&^bq�b_�b!Wcyc�c�c�c�c�c�cdd8d-<djd-�d$�d�d�d
e	ee0e%<e$be%�e�e�e�e�e�eC�e",fOf)gf&�f�f
�f�f	�f	�f�fgg g(g@gFg]gsgF�g�g�g�g�ghh0hCh
Thbhth�h�h�h�hW�hY(i�i�i�i�i�i�i�i4jDjPj_jnjuj}j�j�j�j�j�j	�j�j�j	k
k	k+$k	PkTZk�k�k�k"�k�k
l"l:lXl
il
tll�l�l�l�l�l�lm"mAmXmum�m�m�m�m(�mn, n#Mn#qn�n�n#�n"�n�no9oKo^o$ro?�o%�o�o$p*p%@pfp}p	�p�p �p�p�p�pq'qFq \q }q	�qJ�q>�qE2r&xr�r�r�r�r9�r.-s@\s@�sG�sT&t"{t�t�t�t�t�t
u!u>u\umu}u�u�u
�u�u�u�u�u
�u�uvv-vGvavzv�v�v�v�v�vw(w%1w$Ww!|w�w+�w-�w
x!x
4x?xExTx"nx�x"�x�x
�x�x y,y@y\yyy�y�y�y �y�y�y�y
z&z+z;zZzoz�z�z�z�z�z�z�z{{{-{>{Y{m{*v{#�{�{�{�{||$|$6|A[|;�|.�|(}1}C}T}'q}�}�}�}�}�}~8~L~j~�~�~�~�~�~�~)�~ 8%Sy#������34�@h�#��̀(߀�%!�G�4c�����	��݁3��.�7�I�$a���.��	͂	ׂ	�	����	���-�$6�![�(}�%��̃���8�T�
\�j�~�������ل'��*�%B�h���"����$��+�2�C�S�e�u���)��φ߆���'�=�R�"r�"��(��
�� �=$�
b�p���!��ʈ#�)�.�D�`�q���������ĉ׉�&�-�H�Y�k� t�������ˊҊ����$8�
]�k������� ��ۋ����"�8�M�"m���"��(Ќ�� �&�:�T�h�0~���ˍ؍ލ���)�;�J�S�	\�f�
{���
������Ď���	��4�&T�{���"��ۏ���;�[�x�������
Đϐ�	�&��)$�$N�'s�&��)‘$�'�&9�)`�$��'��&ג)��$(�'M�u�������͓ޓ��"� ?�	`�j�}�����ʔ��'��"�@�	`�j�p�v���������"ѕ��&�
=�K�T�f�y�������Ė%ږ&�'�A�H�a�i�	����������!˗��!�3�D�K�S�X�_������˘ݘ���.�@�\�t�������љ�	���*�#.�R�Z�f�}�(����Ϛ"��#�8�U�f�)��-��ݛ���8(�!a���	����4�����D�
U�`�i�e��7� �'�7�M�
a�l�������.Ȟ(�� �6�?�O� i��� ��#˟!�(� :�+[�%������ՠ�'�*�:�O�_�%~�)��
Ρܡ��
#�.�	H�
R�4`�&�� ��"ݢ%�%&�"L�&o�����ͣ�a�h���	����)���(�(�?�X�i�o���������ť)ʥ���8�N�k� ~����� ɦ�&�"+�)N�x�"��#��٧	��	����*�;�R�a�v���&����*Ϩ#���:�$W�#|�������ĩЩ�#�#�=8�Mv�#ĪM�^6�����%ƫ��	�$�8�K�#a�������̬Sլ&)�&P�w�1��ȭͭխ
ۭ�
��!�(�;�O�a�g�w��������� ��ݮ����-�,=�4j�����ѯ����&�
A�L�`�(|�,��Ұ!�!�2�G�$^�*��$��ӱ���;�S�o�u�����	��²ܲf��!_�%��
����ͳ���	��f,����� ��д����.�J�
^�i�q�
������ǵ"�!	�+�!?�"a�#������(ڶ� �;�L�h�{�����!̷�� �+>�j�
~�������¸ݸ�
���%�"-�&P�w������� ع��0
�;�$O�t�9��ƺֺߺ�����"&�I�\�c�#s�����	ɻ&ӻ����/�,H�!u� ��$��&ݼ,�1�E�\�o�����7����&�<�V�l�}�����*¾���*�=�U�l�����ſ߿���� �7�"J�"m�����������	
��+�1�@�Q�-q�(���"�$�%�9�?�F�_�o�t�������,��+��+�E�]�q�;��d��&�:�I�`�g�o��������������	�"�?�.\�*������	�������'�:�O�i�-��N������3�H�X�m�+}�+�����������
)�
7�B�,W���(����B��c�(��	������������&��K�e^�u��o:�J��o��Je������������������������������������������������	�����1�4�7�:�=�@�C�F�I�L�O�R�X�\�`�c�f�i�l�o�r�u�x�{�~�����������������������������������������������������������������������������������������!�$�'�+�.�1�4�7�:�=�@�D�G�J�M�P�S�V�Y�]�`�c��f�_�6}�|��b1�)����$��'��"�$3�'X���������5�� ��/�,E�r���
��	������2��(�2;�n���������W��D�$E�1j�G��������
 �'+�	S�]�y�+����������\�k�|�����������
��������
/�=�N�_f�c��	*�4�Q� p�������3����,�C�J�	R�\�c�&w�����	������	��
��	��+��(�]>�������"�������(�F�X�`�l�������������$��$�;�U�p�}�������/��#�.,�"[�&~���	��)��&��%�A�]�s���/��P��9"�\�&d���&����������$�=�
D�R�p�����!�� ��
�L�L\�Z��'�,�$B�g���M��D��[4�X��V��N@�'��������#�� �1�H�e�����������
�����������3�L�_�|������������8�R�l�'s�!��#����@��I;�����	��������1��!�.9�!h�����%����$��#�;�C�J�Z�%m�������'����" �C�\�x�����������������1�!I�k�~�/��6�������)�<�M�*_�P��K��6'�1^�����$��/���'�F�V�n�&����������%�>�T�s�6�� ��#��.
�+<�5h������� ���7!�AY�,����1���-'�!U�Aw�����
���� �F2�y�����'���-�
�
-�
;�
I�W�g�m�	r�|���$��!�(�%�9�V�p�������
�����&0�W�>h�%��#�7�>)�	h�!r���-��4�A
�L�_�t�����.�����,�G�Y�r��� ��%�&��"�(9�Bb���(��'�(�4�1S�2��!����� �,�1�4�&O�v�&����&����	1�!;�]�p����������&�'@#Pt��'����!9Kh�$�%�
�&�&%2L �:��',;O^w
�
��	��
���$?
Xf|#�'���"Aa�����
.9	MW,`/�*�-�,/C*s-�,�/�*)-T,�/�*�-
	8	J	g	({	�	�	�	�	�	 
	7
A
T
 j
�
�
�
�
/�
'",	OY	ak����%��(	2N^gy�����%�&
:
X
._
�
�
�
�
�
�
�
+�
!#!Egy����$�� �-G]w������
*CKTk'o�
���(��".Qbv�&�2�6�6E
epA�(��G,t�]�)mC\�	5S	oy���/�)+@IY$s� �#�!�* J+k7����'$L\q�%�+�
��%EQ	q{7�<�/,34`1�-�4� *K!j�g�1
LW/l�5�/�
(7=Z_n��$��'�#�(#Li!|�� ��'"+)Nx"�"�����   1 
I W 
k 
y *� � 1� %� %!C!&b!"�!�!�!�!�!�!	�!""/="Am"�"A�"Q#a#y#*�#�#�#
�#�#$$)3$]$w$�$
�$l�$(+%(T%7}%L�%&&&
&#&+&<&"B&e&x&�&�&�&�&�&�&�&' '%)'O'X's'�'/�'?�''(0(H(Z()r(�(%�(	�(�(�((),:)g)!�)&�)�)�)(�))*#I*m*�*�*�*�*�*++;+O+
e+p+#�+j�+-,3C,w,�,�,�,�,�,�,m-u-}-&�-�-�-�-&�-".?.R.b.h.�.�.�.�.$�./&/#8/$\/$�/�/�/.�/00=0O0l0�0�0�0$�0�0%1=1Y1w1
�1�1�1�1�1�12
2$2>2"D2)g2�2
�2�2�2�2
	3<3T3Df3�3;�3�344	.484X4(`4�4�4�41�4�4)505%95_5z5�5�52�5$�5#	62-6.`6/�6�6�6�6 7(7E7Uc7�7#�7�78'8=8N8h8w8+�8�8�8�8�89!*9#L9"p9"�9�9�9�9�9::/:&C:+j:�:�: �:�:;;
,;7;N;U;h; z;,�;+�;�;!
<#,<P<d<	j<t<�<�<�<�<	�<�<9�<98=9r=�=�=�=@�=c->�>�>�>�>�>�>�>�>�>%?8?	R?\?n?�?�?.�?*�?	@"%@	H@R@k@�@�@�@�@�@7Ak?A�A�A�A�A�AB3BIHBB�B+�B	CCC'CBC
QC\C2qC�C+�C�CE�CyEDK�DEE,E2EBEIE!PE@rER�EdF_kF@�F_G@lG�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�G�GHHH
HHHH2H5H8H;H>HAHDHGHJHMHPHSHYH]HaHdHgHjHmHpHsHvHyH|HH�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�H�HIIIIIIIIII"I%I(I,I/I2I5I8I;I>IAIEIHIKINIQITIWIZI^IaIdI�Z4��d�)'Jr�S�X?��z�x� �]0�_����>�
m{� Y���
��q	���~V$U��#��+X����q��PM[OX/1%��L�� ��Q���;b�9�}=�A��@j�K������J@h������0�}OTTeY-Eh��~�|�+�U"��Wf�����
�M���y\J�,�4a(p3y<5��d���F�{hi���l,����]�'�K���	���&�f�����5B��J��������Dx5F
��/���.�B�{�z8B��^������������Q��J_�H�.(�-�wtA��a{O*����M3c�:!nFl$i~] ���-`�w�8k�x9���������y�2&%�[`1f�W��^_�3���*R�gh="�?'���I
E�U	S�c3?��������#HD�g�������j���k��^�nuEV��\��C�0���`ut��k	y8@��g�i�+?�4�fo��t�1U�leM[*�A.!\�2��$��Y��V����!�g��x��D�7�4O���:�|X�����7���|����N�C=��ZE�-�]s|��;�]���K�k���Y���g:�f��/�����Mn��������IGI�S_�~��s�/N�P���"7QB�Rv�R�6���;F&<���/D1�AoBo������^�K��ov�qX[�*�Zn�����9dDu���(<���^`PNZr&���=���6O�?!���LG8���6+�x��$��,9C���0�N��:��
��')��\`��R���0c�N�Tdi3��#\:rPTrC)�.Hj&�EFa���t�(W>����L���)��{"�sW��$K��;<n�wy��;��2���L���u���ez,�b�w8c7����Q���������|�����b>RH���������)}bmq��l.�������vbsCSh����a�@!>����uG#�o�Y
�l5��(v�G5��7���'����ktL}I}�,�����U���p��2��re�q1���j��d���z��>%���Gp4�m6
%�_�@�V�j�
m���A��me�z�Z9��ST~i��W���+ps�p#��wQ vV�-��%2���6*��I"Pa[���	=<
��H���c&lt;Less/Greater&gt;&lt;Less/Greater&gt; chooses 5th level&lt;Less/Greater&gt; chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser&lt;Less/Greater&gt;; acts as onetime lock when pressed together with another 3rd level chooser3rd level of &lt;Less/Greater&gt;3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as Control, Control as HyperCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (3l)English (3l, chromebook)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)EurKEY (US based layout with European letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Finnish DvorakFour-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AFNOR standardized AZERTY)French (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, AFNOR)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (US, AZERTY)French (US, with French letters)French (US, with French letters, with dead keys, alternative)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianIndonesian (Arab Melayu, ext. phonetic)Indonesian (Arab Melayu, phonetic)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMake unmodified Caps Lock an additional Esc, but Shift + Caps Lock behaves like regular Caps LockMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (UK layout with AltGr overrides)Maltese (US layout with AltGr overrides)Maltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian GalikMongolian ManchuMongolian Manchu GalikMongolian TodoMongolian Todo GalikMongolian XibeMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (British keyboard)Polish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic yazherty)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French, with Vietnamese letters)Vietnamese (QĐERTY)Vietnamese (US, with Vietnamese letters)ViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.27.99
Report-Msgid-Bugs-To: [email protected]
POT-Creation-Date: 2019-10-19 21:52+0100
PO-Revision-Date: 2019-10-09 00:24+0200
Last-Translator: Jean-Philippe Guérard <[email protected]>
Language-Team: French <[email protected]>
Language: fr
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
X-Bugs: Report translation errors to the Language-Team address.
Plural-Forms: nplurals=2; plural=(n>=2);
&lt;Plus petit/Plus grand&gt;&lt;Plus petit/Plus grand&gt; sélectionne le niveau 5&lt;Plus petit/Plus grand&gt; sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveau&lt;Plus petit/Plus grand&gt;, avec  un autre sélecteur de niveau 3, enclenche une fois ce niveauNiveau 3 de &lt;Plus petit/Plus grand&gt;Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles clavier APL : disposition APL unifiée APLXSymboles clavier APL : IBM APL2Symboles clavier APL : Manugistics APL*PLUS IISymboles clavier APL : disposition unifiéeSymboles APL : saxClavier de type téléphoniqueAcer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAjout des lettres accentuées EspérantoAjout des signes monétaires sur certaines touchesAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceComportement des touches Alt et WindowsAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium : émulation des touches PC (Impr. écr. ; défil. ; pause ; Verr. Num.)Apple (portable)ArabeArabe (azerty)Arabe (azerty/chiffres)Arabe (Algérie)Arabe (Buckwalter)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (qwerty)Arabe (Sun type 6/7)Arabe (Syrie)Arabe (chiffres)Arabe (qwerty/chiffres)Arabe (avec extensions pour l'écriture arabe d'autres langues et chiffres arabes en priorité)Arabe (avec extensions pour l'écriture arabe d'autres langues et chiffres européens en priorité)ArménienArménien (phonétique OLPC)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H point bas et L point bas)Asus (portable)En bas à gaucheÀ gauche du « A »AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec  un autre sélecteur de niveau 3, enclenche une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, Inscript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Probhat)Bengali (Inde, Uni Gitanjali)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (obsolète)BelgeBelge (Sun type 6/7)Belge (Wang 724 azerty)Belge (variante ISO)Belge (variante)Belge (variante, Latin-9 uniquement)Belge (variante, touches mortes Sun)Belge (sans touche morte)Belge (touches mortes Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Algérie, latin)Berbère (Algérie, Tifinagh)Berbère (Maroc, Tifinagh variante phonétique)Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US, avec digraphes bosniaques)Bosniaque (US avec lettres bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun multilingue (azerty)Cameroun multilingue (Dvorak)Cameroun multilingue (qwerty)Canadien multilingueCanadien multilingue (1re partie)Canadien multilingue (2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage de maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme Ctrl, Ctrl comme HyperVerr. maj. comme CtrlComportement de la touche Verr. maj.Verr. maj. est également CtrlVerr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, enclenche une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (variante)Cherry CyBo@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US, avec les digraphes croates)Croate (US, avec lettres croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur les touches Alt, Alt sur les touches WindowsCtrl est placé sur les touches Windows (et les touches Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.TchèqueTchèque (qwerty)Tchèque (qwerty, Macintosh)Tchèque (qwerty, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (codage)Tchèque (programmation)Tchèque (programmation, typographie)Tchèque (typographie)Tchèque (avec la touche &lt;\|&gt;)Tchèque, slovaque et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Touches Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (standard)Néerlandais (touches mortes Sun)Dyalog APL completDzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active des caractères typographiques supplémentairesAnglais (3l)Anglais (3l, chromebook)Anglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx,  complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx,  complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Dvorak)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, étendu, touche Windows)Anglais (Royaume-Uni, internat., Macintosh)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (US)Anglais (US, Arabe IBM 238_L)Anglais (US, Sun type 6/7)Anglais (US, variante internat.)Anglais (US, Euro sur le 5)Anglais (US, international, AltGr combinatoire Unicode)Anglais (US, international, AltGr combinatoire Unicode, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (les touches diviser/multiplier basculent la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (point-virgule et guillemets simples déplacés, obsolète)EstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US, avec lettres estoniennes)Estonien (sans touche morte)EurKEY (clavier US avec lettres européennes)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (qwerty, baybayin)FinnoisFinnois (DAS)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Touches Windows)Finnois (classique)Finnois (classique, sans touche morte)Finnois (Dvorak)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (azerty standard AFNOR)Français (azerty)Français (Bépo, ergonomique, façon Dvorak)Français (Bépo, ergonomique, façon Dvorak, AFNOR)Français (Bépo, ergonomique, façon Dvorak, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Guinée)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, sans touche morte)Français (Suisse, touches mortes Sun)Français (Togo)Français (US, azerty)Français (US, avec lettres françaises)Français (US, avec lettres françaises, touches mortes, variante)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, sans touche morte)Français (variante, touches mortes Sun)Français (variante obsolète)Français (variante obsolète, sans touche morte)Français (variante obsolète, touches mortes Sun)Français (sans touche morte Sun)Français (touches mortes Sun)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touches (internat.)PC générique 104 touchesPC générique 105 touches (internat.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, azerty Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, sans touche morte)Allemand (Autriche, touches mortes Sun)Allemand (Bone)Allemand (Bone, ß et q échangés)Allemand (Dvorak)Allemand (KOY)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo qwerty)Allemand (Neo qwertz)Allemand (qwerty)Allemand (Sun type 6/7)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (Suisse, touches mortes Sun)Allemand (T3)Allemand (US, avec lettres allemandes)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec les lettres hongroises, sans touche mortes)Allemand (touches mortes Sun)Allemand (Ladin)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (bolnagri)Hindi (phonétique KaGaPa)Hindi (Wx)Honeywell EuroboardHtc DreamHongroisHongrois (101/qwerty/virgule/touches mortes)Hongrois (101/qwerty/virgule/sans touche morte)Hongrois (101/qwerty/point/touches mortes)Hongrois (101/qwerty/point/sans touche morte)Hongrois (101/qwertz/virgule/touches mortes)Hongrois (101/qwertz/virgule/sans touche morte)Hongrois (101/qwertz/point/touches mortes)Hongrois (101/qwertz/point/sans touche morte)Hongrois (102/qwerty/virgule/touches mortes)Hongrois (102/qwerty/virgule/sans touche morte)Hongrois (102/qwerty/point/touches mortes)Hongrois (102/qwerty/point/sans touche morte)Hongrois (102/qwertz/virgule/touches mortes)Hongrois (102/qwertz/virgule/sans touche morte)Hongrois (102/qwertz/point/touches mortes)Hongrois (102/qwertz/point/sans touche morte)Hongrois (qwerty)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)Islandais (sans touche morte)Islandais (touches mortes Sun)IgboIndienIndonésien (Arabe Malayu, phonétique étendu)Indonésien (Arabe Malayu, phonétique)Alphabet phonétique internationalInuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (IBM 142)Italien (Macintosh)Italien (Sun type 6/7)Italien (US, avec lettres italiennes)Italien (touche Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)Italien (Ladin)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7 - compatible PC)Japonais (Sun type 7 - compatible Sun)Options des claviers japonaisKalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (phonétique KaGaPa)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (disposition proposée par la STEA)LettonLetton (F)Letton (Sun type 6/7)Letton (Colemak US)Letton (Colemak US, variante apostrophe)Letton (Dvorak US)Letton (Dvorak US, variante Y)Letton (Dvorak US, variante moins)Letton (adapté)Letton (apostrophe)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur US)Letton (Dvorak pour le programmeur US, variante Y)Letton (Dvorak pour le programmeur US, variante moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (clavier obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Sun type 6/7)Lituanien (Dvorak US avec lettres lituaniennes)Lituanien (US, avec lettres lituaniennes)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Rester compatible avec les anciens code clavier SolarisFaire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Alt. droite comme touche hangeulAlt. droite comme touche hanjaCtrl. droite comme touche hangeulCtrl. droite comme touche hanjaFaire de Verr. maj. un Échap. supplémentaire, mais Maj. + Verr. maj. a l'effet du Verr. maj. habituelMalais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (Inscript amélioré avec le roupie)MaltaisMaltais (disposition anglaise, débrayable via AltGr)Maltais (disposition US, débrayable via AltGr)Maltais (avec disposition US)Meitei (Eeyek)MaoriMarathi (phonétique KaGaPa)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMenu est placé sur les touches WindowsMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft Wireless Multimedia 1.0ADiverses options de compatibilitéM'mockMoldaveMoldave (Gagaouze)MongolMongol (bichig)Mongol (galik)Mongol (mandchou)Mongol (galik mandchou)Mongol (todo)Mongol (galik todo)Mongol (xibe)MonténégrinMonténégrin (cyrillique avec guillemets)Monténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (latin avec guillemets)Monténégrin (latin, qwerty)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, qwerty)Multilingue (Canada, Sun type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Sami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Touches Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Touche numérique 4 pour un appui isoléTouche numérique 9 pour un appui isoléComportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesOriyaOrtek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (touches Windows)Ossète (obsolète)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)PolonaisPolonais (clavier anglais)Polonais (Colemak)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (qwertz)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Colemak)Portugais (Macintosh)Portugais (Macintosh, sans touche morte)Portugais (Macintosh, touches mortes Sun)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (sans touche morte)Portugais (touches mortes Sun)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite sélectionne le niveau 5Alt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite comme Alt droiteCtrl  droite + Maj. droiteMaj. droiteWindows droiteWindows droite (maintenu)Windows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (touche Windows)Roumain (cédille)Roumain (ergonomique dactylographique)Roumain (standard, cédille)Roumain (standard)Roupie sur le 4RusseRusse (Tchèque, phonétique)Russe (DOS)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (phonétique yazherty)Russe (phonétique)Russe (phonétique, azerty)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, touches Windows)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)Samsung SDM 4500PSamsung SDM 4510PSanscrit (phonétique KaGaPa)Sanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique avec guillemets)Serbe (cyrillique, ZE et ZHE intervertis)Serbe (Latin avec guillemets)Serbe (Latin)Serbe (Latin, qwerty)Serbe (latin, Unicode)Serbe (latin, Unicode, qwerty)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US, avec lettres cingalaises)Cingalais (phonétique)SlovaqueSlovaque (qwerty)Slovaque (qwerty, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US, avec lettres slovènes)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Amérique latine, touches mortes Sun)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (touches Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Espagnol (touches mortes Sun)Les combinaisons spéciales (Ctrl+Alt+&lt;touche&gt;) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Compatibilité avec les touches SunSun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US, avec lettres suédoises)Suédois (basé sur le Dvorak US internat.)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (Inscript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (phonétique KaGaPa)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)TibétainTibétain (avec chiffres ASCII)Vers la touche correspondante sur une disposition Dvorak.Vers la touche correspondante sur une disposition Dvorak.Vers la touche correspondante sur une disposition Qwerty.Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (touches Alt larges)Truly Ergonomic Computer Keyboard Model 229 (touches Alt de taille standard, touches Super et Menu)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (internat., avec touches mortes)Turc (touches mortes Sun)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (touches Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Ajouts Unicode (opérateurs mathématiques et flèches)Ajouts Unicode (opérateurs mathématiques et flèches ; opérateurs mathématiques au niveau par défaut)Unitek KB-1925Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (touches Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les voyants du clavier pour indiquer une disposition alternativeUtiliser la barre d'espacement pour insérer une espace insécableL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français, avec lettres vietnamiennes)Vietnamien (QĐERTY)Vietnamien (US, avec lettres vietnamiennes)ViewSonic KU-306 InternetWang 724 avec ajouts Unicode (opérateurs mathématiques et flèches)Wang 724 avec ajouts Unicode (opérateurs mathématiques et flèches ; opérateurs mathématiques au niveau par défaut)La touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh


Current_dir [ NOT WRITEABLE ] Document_root [ NOT WRITEABLE ]


[ Back ]
NAME
SIZE
LAST TOUCH
USER
CAN-I?
FUNCTIONS
..
--
3 Mar 2024 7.10 PM
root / root
0755
Linux-PAM.mo
11.486 KB
17 Dec 2025 6.54 PM
root / root
0644
NetworkManager.mo
371.704 KB
23 Feb 2023 9.00 AM
root / root
0644
acl.mo
6.561 KB
19 Jun 2018 3.10 AM
root / root
0644
aspell.mo
30.123 KB
18 Apr 2022 3.10 PM
root / root
0644
atk10.mo
10.423 KB
12 Mar 2018 8.03 AM
root / root
0644
authselect.mo
37.017 KB
14 Oct 2023 6.05 PM
root / root
0644
bash.mo
163.46 KB
10 Sep 2016 4.43 PM
root / root
0644
bfd.mo
208.633 KB
27 Jan 2018 3.13 PM
root / root
0644
binutils.mo
273.09 KB
27 Jan 2018 3.13 PM
root / root
0644
bison.mo
26.052 KB
12 Oct 2019 12.28 PM
root / root
0644
chkconfig.mo
11.036 KB
14 Oct 2023 10.48 PM
root / root
0644
coreutils.mo
368.827 KB
24 Mar 2026 1.05 PM
root / root
0644
cpio.mo
31.223 KB
12 Sep 2015 11.33 AM
root / root
0644
cpplib.mo
25.374 KB
26 Aug 2025 9.44 AM
root / root
0644
cpupower.mo
7.196 KB
5 Mar 2026 8.58 PM
root / root
0644
cracklib.mo
1.916 KB
12 Oct 2019 12.47 AM
root / root
0644
cryptsetup.mo
113.403 KB
15 Oct 2023 3.50 AM
root / root
0644
diffutils.mo
36.378 KB
4 May 2020 3.15 PM
root / root
0644
dnf-plugins-core.mo
39.336 KB
8 Apr 2024 10.02 AM
root / root
0644
dnf.mo
93.139 KB
11 Mar 2025 9.47 AM
root / root
0644
dpkg.mo
132.638 KB
13 Apr 2021 10.43 PM
root / root
0644
e2fsprogs.mo
178.476 KB
21 Mar 2020 4.24 AM
root / root
0644
elinks.mo
192.58 KB
14 Oct 2019 7.31 PM
root / root
0644
findutils.mo
41.996 KB
28 Dec 2015 9.37 PM
root / root
0644
firewalld.mo
41.097 KB
11 Mar 2025 9.51 AM
root / root
0644
flex.mo
16.156 KB
12 Oct 2019 12.33 PM
root / root
0644
gas.mo
525.148 KB
27 Jan 2018 3.13 PM
root / root
0644
gawk.mo
86.604 KB
25 Feb 2018 5.17 PM
root / root
0644
gcc.mo
1.7 MB
26 Aug 2025 9.44 AM
root / root
0644
gdbm.mo
15.369 KB
8 Oct 2022 1.22 PM
root / root
0644
gdk-pixbuf.mo
24.518 KB
7 Apr 2018 6.35 PM
root / root
0644
gettext-runtime.mo
9.282 KB
11 Jun 2016 1.08 PM
root / root
0644
gettext-tools.mo
124.655 KB
11 Jun 2016 1.08 PM
root / root
0644
git.mo
660.322 KB
23 Jul 2025 6.59 AM
root / root
0644
glib20.mo
132.38 KB
18 Dec 2018 4.13 PM
root / root
0644
gnupg2.mo
209.76 KB
20 Mar 2020 2.40 PM
root / root
0644
gnutls.mo
34.335 KB
24 Mar 2026 3.08 PM
root / root
0644
gold.mo
84.938 KB
27 Jan 2018 3.13 PM
root / root
0644
gprof.mo
11.147 KB
27 Jan 2018 3.13 PM
root / root
0644
grep.mo
12.446 KB
11 Oct 2019 3.15 PM
root / root
0644
grub.mo
131.364 KB
21 Oct 2025 1.34 PM
root / root
0644
gst-plugins-bad-1.0.mo
3.943 KB
23 Sep 2019 10.15 AM
root / root
0644
gst-plugins-base-1.0.mo
19.302 KB
23 Sep 2019 10.06 AM
root / root
0644
gstreamer-1.0.mo
38.903 KB
23 Sep 2019 10.01 AM
root / root
0644
gtk20.mo
58.268 KB
6 Apr 2021 1.52 PM
root / root
0644
initdb-10.mo
24.457 KB
27 Feb 2024 8.24 AM
root / root
0644
initscripts.mo
17.603 KB
10 Nov 2025 10.42 AM
root / root
0644
iso_15924.mo
10.027 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_3166-1.mo
23.671 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_3166-2.mo
201.128 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_3166-3.mo
2.814 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_3166.mo
23.671 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_3166_2.mo
201.128 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_4217.mo
9.23 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_639-2.mo
22.479 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_639-3.mo
404.344 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_639-5.mo
7.741 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_639.mo
22.479 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_639_3.mo
404.344 KB
13 Oct 2019 3.41 PM
root / root
0644
iso_639_5.mo
7.741 KB
13 Oct 2019 3.41 PM
root / root
0644
kbd.mo
30.341 KB
14 Oct 2023 8.59 PM
root / root
0644
ld.mo
61.079 KB
27 Jan 2018 3.13 PM
root / root
0644
libdnf.mo
27.589 KB
29 Jan 2025 6.59 AM
root / root
0644
libexif-12.mo
117.784 KB
26 Jan 2021 5.41 PM
root / root
0644
libgpg-error.mo
22.172 KB
12 Oct 2019 12.20 PM
root / root
0644
libidn.mo
8.842 KB
13 Oct 2019 4.55 PM
root / root
0644
libidn2.mo
4.983 KB
23 May 2019 10.10 AM
root / root
0644
libpaper.mo
2.231 KB
12 Oct 2019 8.09 PM
root / root
0644
libpq5-13.mo
33.427 KB
15 Jan 2026 2.59 PM
root / root
0644
libpwquality.mo
6.212 KB
13 Oct 2020 6.32 AM
root / root
0644
libsecret.mo
1.563 KB
15 Nov 2019 9.37 AM
root / root
0644
libuser.mo
26.918 KB
23 Jul 2015 7.16 PM
root / root
0644
lynx.mo
144.04 KB
18 Apr 2022 9.01 PM
root / root
0644
make.mo
42.846 KB
18 Apr 2022 4.38 PM
root / root
0644
man-db-gnulib.mo
5.13 KB
12 Dec 2016 12.44 PM
root / root
0644
man-db.mo
20.175 KB
12 Dec 2016 12.44 PM
root / root
0644
mc.mo
87.172 KB
4 Mar 2017 5.56 PM
root / root
0644
nagios-plugins.mo
86.682 KB
27 Feb 2026 7.23 AM
root / root
0644
nano.mo
52.304 KB
2 Jun 2018 8.23 AM
root / root
0644
net-tools.mo
39.967 KB
30 Aug 2020 5.47 PM
root / root
0644
newt.mo
0.562 KB
1 Jun 2020 2.11 PM
root / root
0644
opcodes.mo
39.285 KB
27 Jan 2018 3.13 PM
root / root
0644
p11-kit.mo
8.034 KB
6 Apr 2024 2.16 PM
root / root
0644
parted.mo
67.396 KB
8 Oct 2021 3.43 PM
root / root
0644
passwd.mo
6.673 KB
18 Apr 2022 10.59 PM
root / root
0644
pg_basebackup-10.mo
34.836 KB
27 Feb 2024 8.24 AM
root / root
0644
pg_controldata-10.mo
10.394 KB
27 Feb 2024 8.24 AM
root / root
0644
pg_ctl-10.mo
19.282 KB
27 Feb 2024 8.24 AM
root / root
0644
pg_dump-10.mo
68.094 KB
27 Feb 2024 8.24 AM
root / root
0644
pg_resetwal-10.mo
14.04 KB
27 Feb 2024 8.24 AM
root / root
0644
pg_rewind-10.mo
20.623 KB
27 Feb 2024 8.24 AM
root / root
0644
pg_upgrade-10.mo
44.765 KB
27 Feb 2024 8.24 AM
root / root
0644
pgscripts-10.mo
27.036 KB
27 Feb 2024 8.24 AM
root / root
0644
plpgsql-10.mo
19.763 KB
27 Feb 2024 8.24 AM
root / root
0644
plymouth.mo
0.762 KB
5 Nov 2025 8.10 AM
root / root
0644
policycoreutils.mo
7.747 KB
2 Jul 2024 9.04 PM
root / root
0644
popt.mo
1.801 KB
23 Jun 2020 11.15 AM
root / root
0644
postgres-10.mo
671.574 KB
27 Feb 2024 8.24 AM
root / root
0644
psmisc.mo
12.31 KB
6 Nov 2020 2.24 PM
root / root
0644
psql-10.mo
108.738 KB
27 Feb 2024 8.24 AM
root / root
0644
pulseaudio.mo
68.621 KB
23 Nov 2020 6.32 PM
root / root
0644
quota.mo
27.066 KB
9 Oct 2021 5.03 AM
root / root
0644
recode.mo
11.026 KB
18 Oct 2019 3.18 PM
root / root
0644
rhn-client-tools.mo
64.449 KB
29 May 2025 1.47 PM
root / root
0644
rhnsd.mo
0.923 KB
17 Sep 2024 10.14 AM
root / root
0644
rpm.mo
63.59 KB
17 Dec 2024 4.11 AM
root / root
0644
sed.mo
15.741 KB
18 Apr 2022 9.41 PM
root / root
0644
shadow.mo
0.523 KB
29 Apr 2018 4.46 PM
root / root
0644
sssd.mo
83.566 KB
10 Feb 2026 5.01 PM
root / root
0644
sudo.mo
21.605 KB
18 Dec 2025 2.01 PM
root / root
0644
sudoers.mo
70.454 KB
18 Dec 2025 2.01 PM
root / root
0644
syspurpose.mo
8.405 KB
15 Jul 2025 9.13 AM
root / root
0644
sysstat.mo
12.965 KB
3 Jul 2024 9.57 AM
root / root
0644
systemd.mo
19.45 KB
4 Mar 2026 8.03 AM
root / root
0644
tar.mo
63.97 KB
26 Aug 2025 8.57 AM
root / root
0644
usermode.mo
11.089 KB
8 Oct 2021 7.28 PM
root / root
0644
util-linux.mo
455.849 KB
4 Feb 2026 8.18 PM
root / root
0644
wget.mo
79.133 KB
13 Aug 2024 10.22 PM
root / root
0644
whois.mo
9.502 KB
4 May 2020 7.38 PM
root / root
0644
xkeyboard-config.mo
82.351 KB
19 Oct 2019 8.52 PM
root / root
0644
xz.mo
24.099 KB
29 Apr 2018 3.19 PM
root / root
0644

GRAYBYTE WORDPRESS FILE MANAGER @ 2025 CONTACT ME
Static GIF